PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G02780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 281aa    MW: 30924.6 Da    PI: 9.944
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G02780.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21.1e-091560347
                     SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                     +W++eE +++ +a + l  +  +W+++ar ++ gR++ ++ ++++++
  ORUFI01G02780.1 15 KWSPEENKQFERALAGLDLRcpDWDRVARAIP-GRSALEVMNHFRDL 60
                     8*****************99************.***********976 PP

2Myb_DNA-binding48.22.4e-15128172347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  ORUFI01G02780.1 128 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 172
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.5E-51263IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-51459IPR009057Homeodomain-like
SuperFamilySSF466892.77E-81568IPR009057Homeodomain-like
PROSITE profilePS500906.2841561IPR017877Myb-like domain
PfamPF002493.5E-81560IPR001005SANT/Myb domain
CDDcd001671.02E-71560No hitNo description
PROSITE profilePS5129418.359121177IPR017930Myb domain
SuperFamilySSF466896.28E-18122177IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-17124175IPR006447Myb domain, plants
SMARTSM007173.4E-13125175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-12125171IPR009057Homeodomain-like
CDDcd001676.60E-12128173No hitNo description
PfamPF002499.2E-13128172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDHYASRGNW FMARKWSPEE NKQFERALAG LDLRCPDWDR VARAIPGRSA LEVMNHFRDL  60
ELDVQQIENG MVPFPVYGAA AAGGAFTLQW DGAHGVGDFR NAYRFGGGGG GKRHFGRTPE  120
QERKKGVPWT EEEHKLFLLG LKKYGKGDWR NISRNFVQTR TPTQVASHAQ KYFIRLNSGG  180
KDKRRSSIHD ITTVNLTDDR PPSPSQSSLI SNQSNTSTLT AAVAPFSSTA DVKPQNAANA  240
SFNSPSRTLG MAGYGMGLQD QGLQCGGPLH DQLAASLSIL F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-13577373RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4056590.0CU405659.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C108P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621817.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0MR710.0A0A0E0MR71_ORYRU; Uncharacterized protein
STRINGLOC_Os01g04930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-63MYB family protein